FKBP25 Antibody
| Name | FKBP25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87929 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FKBP25 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FKBP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FKBP25 Antibody [NBP1-87929] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/46_FKBP25-Antibody-Western-Blot-NBP1-87929-img0003.jpg)
Western Blot: FKBP25 Antibody [NBP1-87929] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunocytochemistry/Immunofluorescence: FKBP25 Antibody [NBP1-87929] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/47_FKBP25%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87929-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FKBP25 Antibody [NBP1-87929] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: FKBP25 Antibody [NBP1-87929] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal and glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/48_FKBP25-Antibody-Immunohistochemistry-Paraffin-NBP1-87929-img0001.jpg)
Immunohistochemistry-Paraffin: FKBP25 Antibody [NBP1-87929] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal and glial cells.
![Western Blot: FKBP25 Antibody [NBP1-87929] - Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/49_FKBP25-Antibody-Western-Blot-NBP1-87929-img0002.jpg)
Western Blot: FKBP25 Antibody [NBP1-87929] - Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue