Aldolase C Antibody

Name	Aldolase C Antibody
Supplier	Novus Biologicals
Catalog	NBP1-90954
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
Purity/Format	Immunogen affinity purified
Blocking Peptide	Aldolase C Protein
Description	Rabbit Polyclonal
Gene	ALDOC
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: Aldolase C Antibody [NBP1-90954] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol.

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human hippocampus shows strong positivity in subsets of glial cells.

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex tissue.