Renin R Antibody
| Name | Renin R Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90820 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Renin R Protein |
| Description | Rabbit Polyclonal |
| Gene | ATP6AP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Renin R Antibody [NBP1-90820] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1746_Renin-R-Antibody-Western-Blot-NBP1-90820-img0010.jpg)
Western Blot: Renin R Antibody [NBP1-90820] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: Renin R Antibody [NBP1-90820] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1747_Renin-R-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90820-img0005.jpg)
Immunocytochemistry/Immunofluorescence: Renin R Antibody [NBP1-90820] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli. Antibody staining is shown in green.
![Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1748_Renin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-90820-img0011.jpg)
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.
![Western Blot: Renin R Antibody [NBP1-90820] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1749_Renin-R-Antibody-Western-Blot-NBP1-90820-img0009.jpg)
Western Blot: Renin R Antibody [NBP1-90820] - Analysis in human cell line HEK 293.
![Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1750_Renin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-90820-img0006.jpg)
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.
![Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/1751_Renin-R-Antibody-Immunohistochemistry-Paraffin-NBP1-90820-img0008.jpg)
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.