PTPLA Antibody
| Name | PTPLA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31903 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LPLSPTSPRCAATMASSDEDGTNGGASEAGEDREAPGKRRRLGFLATAW |
| Description | Rabbit Polyclonal |
| Gene | HACD1 |
| Supplier Page | Shop |
Product images
![Western Blot: PTPLA Antibody [NBP2-31903] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28370_PTPLA-Antibody-Western-Blot-NBP2-31903-img0008.jpg)
Western Blot: PTPLA Antibody [NBP2-31903] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: PTPLA Antibody [NBP2-31903] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28371_PTPLA-Antibody-Immunohistochemistry-NBP2-31903-img0006.jpg)
Immunohistochemistry: PTPLA Antibody [NBP2-31903] - liver cancer
![Western Blot: PTPLA Antibody [NBP2-31903] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28372_PTPLA-Antibody-Western-Blot-NBP2-31903-img0003.jpg)
Western Blot: PTPLA Antibody [NBP2-31903] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: PTPLA Antibody [NBP2-31903] - Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28373_PTPLA-Antibody-Immunohistochemistry-NBP2-31903-img0002.jpg)
Immunohistochemistry: PTPLA Antibody [NBP2-31903] - Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
![Immunohistochemistry: PTPLA Antibody [NBP2-31903] - Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28374_PTPLA-Antibody-Immunohistochemistry-NBP2-31903-img0004.jpg)
Immunohistochemistry: PTPLA Antibody [NBP2-31903] - Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
![Immunohistochemistry: PTPLA Antibody [NBP2-31903] - smooth muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28375_PTPLA-Antibody-Immunohistochemistry-NBP2-31903-img0005.jpg)
Immunohistochemistry: PTPLA Antibody [NBP2-31903] - smooth muscle