Wnt-2 Antibody

Name	Wnt-2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-83103
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:GSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNL
Description	Rabbit Polyclonal
Gene	WNT2
Supplier Page	Shop

Western Blot: WNT2 Antibody [NBP1-83103] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: WNT2 Antibody [NBP1-83103] - Staining of human rectum shows strong positivity in glandular cells.

Jiang H, Li Q, He C, Li F, Sheng H, Shen X, Zhang X, Zhu S, Chen H, Chen X, Yang C, Gao H. Am J Cancer Res. 2014 Sep 6;4(5):537-44. eCollection 2014.