SHMT2 Antibody

Name	SHMT2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-80755
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL
Purity/Format	Immunogen affinity purified
Blocking Peptide	SHMT2 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	SHMT2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80755] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & microtubules.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in human cell line SK-MEL-30.