UGP2 Antibody (3H3)

Name	UGP2 Antibody (3H3)
Supplier	Novus Biologicals
Catalog	H00007360-M01
Prices	$359.00
Sizes	100 µg
Host	Mouse
Clonality	Monoclonal
Isotype	IgG2a Kappa
Clone	3H3
Applications	WB ELISA Gene Silencing
Species Reactivities	Human, Rat
Antigen	UGP2 (NP_001001521, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Purity/Format	IgG purified
Description	Mouse Monoclonal
Gene	UGP2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in NIH/3T3.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi ( Cat # H00007360-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UGP2 monoclonal antibody (M01), clone 3H3 (Cat # H00007360-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3 Analysis of UGP2 expression in HeLa.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in PC-12.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - UGP2 monoclonal antibody (M01), clone 3H3. Analysis of UGP2 expression in Raw 264.7.

Western Blot: UGP2 Antibody (3H3) [H00007360-M01] - Analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody (M01), clone 3H3.Lane 1: UGP2 transfected lysate(56.9 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: UGP2 Antibody (3H3) [H00007360-M01] - Detection limit for recombinant GST tagged UGP2 is approximately 0.1ng/ml as a capture antibody.