ACAA1 Antibody

Name	ACAA1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-55156
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human, Rat
Antigen	Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	ACAA1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: ACAA1 Antibody [NBP1-55156] - Rat purified peroxisomes (33ug) at 1:1000.

Immunohistochemistry: ACAA1 Antibody [NBP1-55156] - Human Liver Tissue Observed Staining: Cytoplasm in granules of hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Fetal Brain tissue lysate at a concentration of 1ug/ml.

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate at 1:1000.

Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate tissue.