PARL Antibody
| Name | PARL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59496 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PARL(presenilin associated, rhomboid-like) The peptide sequence was selected from the N terminal of PARL (NP_001032728). Peptide sequence SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PARL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PARL Antibody [NBP1-59496] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19864_PARL-Antibody-Western-Blot-NBP1-59496-img0007.jpg)
Western Blot: PARL Antibody [NBP1-59496] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: PARL Antibody [NBP1-59496] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19865_PARL-Antibody-Immunohistochemistry-NBP1-59496-img0006.jpg)
Immunohistochemistry: PARL Antibody [NBP1-59496] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
![Western Blot: PARL Antibody [NBP1-59496] - Jurkat cell lysate, concentration 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19866_PARL-Antibody-Western-Blot-NBP1-59496-img0002.jpg)
Western Blot: PARL Antibody [NBP1-59496] - Jurkat cell lysate, concentration 0.5ug/ml.
![Immunohistochemistry-Paraffin: PARL Antibody [NBP1-59496] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19867_PARL-Antibody-Immunohistochemistry-Paraffin-NBP1-59496-img0004.jpg)
Immunohistochemistry-Paraffin: PARL Antibody [NBP1-59496] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.