GPSM2 Antibody
| Name | GPSM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-53125 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GPSM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GPSM2 Antibody [NBP1-53125] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1868_GPSM2%2520Antibody-Western%2520Blot-NBP1-53125-img0012.jpg)
Western Blot: GPSM2 Antibody [NBP1-53125] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml
![Immunocytochemistry/Immunofluorescence: GPSM2 Antibody [NBP1-53125] - Human cell lines.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1869_GPSM2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-53125-img0009.jpg)
Immunocytochemistry/Immunofluorescence: GPSM2 Antibody [NBP1-53125] - Human cell lines.
![Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Paraffin Embedded Tissue: Human Liver Antibody Concentration: 5 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1870_GPSM2-Antibody-Immunohistochemistry-NBP1-53125-img0011.jpg)
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Paraffin Embedded Tissue: Human Liver Antibody Concentration: 5 ug/ml
![Western Blot: GPSM2 Antibody [NBP1-53125] - Human Fetal Liver Lysate, concentration 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1871_GPSM2-Antibody-Western-Blot-NBP1-53125-img0002.jpg)
Western Blot: GPSM2 Antibody [NBP1-53125] - Human Fetal Liver Lysate, concentration 1ug/ml.
![Immunohistochemistry-Paraffin: GPSM2 Antibody [NBP1-53125] - Human Placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1872_GPSM2-Antibody-Immunohistochemistry-Paraffin-NBP1-53125-img0004.jpg)
Immunohistochemistry-Paraffin: GPSM2 Antibody [NBP1-53125] - Human Placenta.
![Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1873_GPSM2-Antibody-Immunohistochemistry-NBP1-53125-img0010.jpg)
Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.