PGRMC1 Antibody

Name	PGRMC1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-83220
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB Simple Western ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Purity/Format	Immunogen affinity purified
Blocking Peptide	PGRMC1 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	PGRMC1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: PGRMC1 Antibody [NBP1-83220] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & endoplasmic reticulum.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).