ACAT Antibody
| Name | ACAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32052 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACAT Protein |
| Description | Rabbit Polyclonal |
| Gene | SOAT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ACAT Antibody [NBP2-32052] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28668_ACAT%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32052-img0008.jpg)
Immunocytochemistry/Immunofluorescence: ACAT Antibody [NBP2-32052] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
![Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28669_ACAT-Antibody-Immunohistochemistry-Paraffin-NBP2-32052-img0007.jpg)
Immunohistochemistry-Paraffin: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28670_ACAT-Antibody-Immunohistochemistry-NBP2-32052-img0003.jpg)
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver.
![Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28671_ACAT-Antibody-Immunohistochemistry-NBP2-32052-img0004.jpg)
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of liver cancer.
![Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28672_ACAT-Antibody-Immunohistochemistry-NBP2-32052-img0006.jpg)
Immunohistochemistry: ACAT Antibody [NBP2-32052] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.