GP2 Antibody

Name	GP2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-59912
Prices	$369.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to GP2(glycoprotein 2 (zymogen granule membrane)) The peptide sequence was selected from the middle region of GP2. Peptide sequence SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	GP2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: GP2 Antibody [NBP1-59912] - Staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Western Blot: GP2 Antibody [NBP1-59912] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that GP2 is expressed in HepG2