| Name | Dopa Decarboxylase/DDC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56918 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DDC(dopa decarboxylase (aromatic L-amino acid decarboxylase)) The peptide sequence was selected from the N terminal of DDC (NP_000781). Peptide sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE. |
| Purity/Format | Protein A purified |
| Blocking Peptide | Dopa Decarboxylase/DDC Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | DDC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |