ARF1 Antibody
| Name | ARF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58941 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to ARF1(ADP-ribosylation factor 1) The peptide sequence was selected from the middle region of ARF1. Peptide sequence MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARF3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ARF1 Antibody [NBP1-58941] - Middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8884_ARF1-Antibody-Western-Blot-NBP1-58941-img0006.jpg)
Western Blot: ARF1 Antibody [NBP1-58941] - Middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.
![Immunohistochemistry-Paraffin: ARF1 Antibody [NBP1-58941] - Mouse brain stem cells, 2 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8885_ARF1-Antibody-Immunohistochemistry-Paraffin-NBP1-58941-img0003.jpg)
Immunohistochemistry-Paraffin: ARF1 Antibody [NBP1-58941] - Mouse brain stem cells, 2 ug/ml.
![Western Blot: ARF1 Antibody [NBP1-58941] - Human Fetal lung Lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8886_ARF1-Antibody-Western-Blot-NBP1-58941-img0001.jpg)
Western Blot: ARF1 Antibody [NBP1-58941] - Human Fetal lung Lysate, concentration 0.2-1 ug/ml.
![Western Blot: ARF1 Antibody [NBP1-58941] - Rat brain homogenate at 1:500.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8887_ARF1-Antibody-Western-Blot-NBP1-58941-img0002.jpg)
Western Blot: ARF1 Antibody [NBP1-58941] - Rat brain homogenate at 1:500.
![Western Blot: ARF1 Antibody [NBP1-58941] - Titration: 2 ug/ml Positive Control: Rat brain homogenate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8888_ARF1-Antibody-Western-Blot-NBP1-58941-img0005.jpg)
Western Blot: ARF1 Antibody [NBP1-58941] - Titration: 2 ug/ml Positive Control: Rat brain homogenate