TRNT1 Antibody
| Name | TRNT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86589 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TRNT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRNT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13244_TRNT1-Antibody-Western-Blot-NBP1-86589-img0010.jpg)
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13245_TRNT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86589-img0004.jpg)
Immunocytochemistry/Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13246_TRNT1-Antibody-Immunohistochemistry-Paraffin-NBP1-86589-img0002.jpg)
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
![Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13247_TRNT1-Antibody-Western-Blot-NBP1-86589-img0009.jpg)
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in human cell line A-549.
![Simple Western: TRNT1 Antibody [NBP1-86589] - Simple Western lane view shows a specific band for TRNT1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/13248_TRNT1-Antibody-Simple-Western-NBP1-86589-img0008.jpg)
Simple Western: TRNT1 Antibody [NBP1-86589] - Simple Western lane view shows a specific band for TRNT1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.