PMP70 Antibody (CL2524)

Name	PMP70 Antibody (CL2524)
Supplier	Novus Biologicals
Catalog	NBP2-36770
Prices	$129.00, $419.00
Sizes	25 µl, 100 µl
Host	Mouse
Clonality	Monoclonal
Isotype	IgG1
Clone	CL2524
Applications	ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
Purity/Format	Protein A purified
Description	Mouse Monoclonal
Gene	ABCD3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U251 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human small intestine shows strong granular cytoplasmic immunoreactivity in the glandular epithelium.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in HeLa cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human cell line A431 showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in MCF7 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U2OS cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human rectum shows strong granular cytoplasmic immunoreactivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human prostate shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human liver shows strong granular cytoplasmic immunoreactivity in hepatocytes.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human kidney shows strong granular cytoplasmic immunoreactivity in renal tubules.