MRP1 Antibody (IU5C1)
| Name | MRP1 Antibody (IU5C1) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NB110-57131 |
| Prices | $99.00, $279.00 |
| Sizes | 25 µl, 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | IU5C1 |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat, Cat |
| Antigen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527] |
| Purity/Format | Unpurified |
| Description | Mouse Monoclonal |
| Gene | ABCC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MRP1 Antibody (IU5C1) [NB110-57131] - Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3320_MRP1%2520Antibody%2520(IU5C1)-Western%2520Blot-NB110-57131-img0002.jpg)
Western Blot: MRP1 Antibody (IU5C1) [NB110-57131] - Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.
![Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU5C1) [NB110-57131] - Immunofluorescent staining of MRP1 using NB110-57131 in HEK293 cells with MRP1 expression.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3321_MRP1%2520Antibody%2520(IU5C1)-Immunocytochemistry-Immunofluorescence-NB110-57131-img0006.jpg)
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU5C1) [NB110-57131] - Immunofluorescent staining of MRP1 using NB110-57131 in HEK293 cells with MRP1 expression.