Kynureninase Antibody

Name	Kynureninase Antibody
Supplier	Novus Biologicals
Catalog	NBP1-56545
Prices	$329.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to KYNU(kynureninase (L-kynurenine hydrolase)) The peptide sequence was selected from the C terminal of KYNU. Peptide sequence LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	KYNU
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: Kynureninase Antibody [NBP1-56545] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: HepG2 cell lysate KYNU is supported by BioGPS gene expression data to be expressed in HepG2.

Immunohistochemistry-Paraffin: Kynureninase Antibody [NBP1-56545] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Western Blot: Kynureninase Antibody [NBP1-56545] - KYNU Antibody [NBP1-56545] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml