FNBP3 Antibody
| Name | FNBP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87933 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FNBP3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRPF40A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis in human cell line CACO-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10325_FNBP3-Antibody-Western-Blot-NBP1-87933-img0008.jpg)
Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis in human cell line CACO-2.
![Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10326_FNBP3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87933-img0009.jpg)
Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
![Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10327_FNBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-87933-img0002.jpg)
Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.
![Simple Western: FNBP3 Antibody [NBP1-87933] - Simple Western lane view shows a specific band for FNBP3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10328_FNBP3-Antibody-Simple-Western-NBP1-87933-img0006.jpg)
Simple Western: FNBP3 Antibody [NBP1-87933] - Simple Western lane view shows a specific band for FNBP3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.
![Simple Western: FNBP3 Antibody [NBP1-87933] - Electropherogram image(s) of corresponding Simple Western lane view. FNBP3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10329_FNBP3-Antibody-Simple-Western-NBP1-87933-img0007.jpg)
Simple Western: FNBP3 Antibody [NBP1-87933] - Electropherogram image(s) of corresponding Simple Western lane view. FNBP3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).