Desmocollin-1 Antibody
| Name | Desmocollin-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88099 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Desmocollin-1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DSC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8003_Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88099-img0008.jpg)
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8004_Desmocollin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88099-img0007.jpg)
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.
![Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8005_Desmocollin-1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-88099-img0009.jpg)
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.
![Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8006_Desmocollin-1-Antibody-Simple-Western-NBP1-88099-img0005.jpg)
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/8007_Desmocollin-1-Antibody-Simple-Western-NBP1-88099-img0006.jpg)
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s).