PCCB Antibody

Name	PCCB Antibody
Supplier	Novus Biologicals
Catalog	NBP1-85886
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB Simple Western IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:SSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVL
Purity/Format	Immunogen affinity purified
Blocking Peptide	PCCB Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	PCCB
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: PCCB Antibody [NBP1-85886] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PCCB Antibody [NBP1-85886] - Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Simple Western: PCCB Antibody [NBP1-85886] - Simple Western lane view shows a specific band for PCCB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PCCB Antibody [NBP1-85886] - Electropherogram image(s) of corresponding Simple Western lane view. PCCB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).