ADPRHL2 Antibody

Name	ADPRHL2 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-88835
Prices	$419.00
Sizes	100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
Purity/Format	Immunogen affinity purified
Blocking Peptide	ADPRHL2 Recombinant Protein Antigen
Description	Rabbit Polyclonal
Gene	ADPRHL2
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: ADPRHL2 Antibody [NBP1-88835] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: ADPRHL2 Antibody [NBP1-88835] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry: ADPRHL2 Antibody [NBP1-88835] - Staining of breast carcinoma, nuclear and cytoplasmic staining. Image from verified customer review.

Western Blot: ADPRHL2 Antibody [NBP1-88835] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88835] - Staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.