LONP1 Antibody
| Name | LONP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81734 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LONP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LONP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LONP1 Antibody [NBP1-81734] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29907_LONP1%2520Antibody-Western%2520Blot-NBP1-81734-img0010.jpg)
Western Blot: LONP1 Antibody [NBP1-81734] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
![Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29908_LONP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81734-img0009.jpg)
Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29909_LONP1-Antibody-Immunohistochemistry-Paraffin-NBP1-81734-img0001.jpg)
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
![Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in human cell line SK-MEL-30.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29910_LONP1-Antibody-Western-Blot-NBP1-81734-img0006.jpg)
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in human cell line SK-MEL-30.
![Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29911_LONP1-Antibody-Simple-Western-NBP1-81734-img0003.jpg)
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29912_LONP1-Antibody-Simple-Western-NBP1-81734-img0005.jpg)
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).