UQCRFS1 Antibody
| Name | UQCRFS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87826 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UQCRFS1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UQCRFS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22105_UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0011.jpg)
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22106_UQCRFS1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87826-img0012.jpg)
Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
![Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22107_UQCRFS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87826-img0008.jpg)
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
![Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22108_UQCRFS1-Antibody-Western-Blot-NBP1-87826-img0010.jpg)
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.
![Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22109_UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0007.jpg)
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22110_UQCRFS1-Antibody-Simple-Western-NBP1-87826-img0009.jpg)
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).