beta-1 Adrenergic R/ADRB1 Antibody

Name	beta-1 Adrenergic R/ADRB1 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-59007
Prices	$329.00
Sizes	50 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	ADRB1
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20ug HepG2 lysate

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Heart Antibody Dilution: 1.0ug/ml.

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Lung Antibody Dilution: 1.0ug/m.

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Muscle Antibody Dilution: 1.0ug/ml

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Adult Placenta Antibody Dilution: 1.0ug/ml.