Anti-Peptide YY / PYY Antibody
| Name | Anti-Peptide YY / PYY Antibody |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C343848 |
| Prices | $405.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Antigen | Peptide YY / PYY antibody was raised against natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.). |
| Purity/Format | Antiserum |
| Description | Rabbit Polyclonal |
| Gene | PYY |
| Supplier Page | Shop |
Product images
Immunohistochemistry: De-waxed sections of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to glucagon. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.
Immunohistochemistry: De-waxed section of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to PYY. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.