| Name | 4933408B17Rik antibody |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb324818 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Zebrafish, Guinea Pig, Dog, Horse, Pig |
| Antigen | Synthetic peptide located within the following region: MDLTTLKRNLSKGRIHTMAEFQRDLMLMFQNAVMYNDSDHHIYHMAVEMQ |
| Purity/Format | Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description | Rabbit polyclonal antibody to 4933408B17Rik |
| Gene | 4933408B17Rik |
| Conjugate | Unconjugated |
| Supplier Page | Shop |