| Name | Anti-Galactosidase-alpha-Picoband-trade-Antibody |
|---|---|
| Supplier | Abgent, a WuXi AppTec company |
| Catalog | ABO10155 |
| Prices | $240.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids. |
| Purity/Format | Lyophilized |
| Description | Rabbit Polyclonal |
| Gene | Gla |
| Supplier Page | Shop |