| Name | Gla, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS178636 |
| Prices | $280.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Anti-Gla Antibody |
| Gene | Gla |
| Supplier Page | Shop |