Anti-HB (aa 1-50) polyclonal antibody

Name Anti-HB (aa 1-50) polyclonal antibody
Supplier Creative Diagnostics
Catalog CABT-BL1756
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Drosophila
Antigen Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNS VASSPRQSPIP) of Human hunchback.
Description Rabbit Polyclonal
Gene hb
Conjugate Unconjugated
Supplier Page Shop