ECHDC3 antibody
| Name | ECHDC3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA346830 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for anti-ECHDC3 antibody: synthetic peptide directed towards the N terminal of human ECHDC3. Synthetic peptide located within the following region: SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ECHDC3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ECHDC3 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate