| Name | Anti-Galactosidase alpha Picoband™ Antibody A01135 |
|---|---|
| Supplier | Boster Bio |
| Catalog | A01135 |
| Prices | $240.00 |
| Sizes | 1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Rabbit Polyclonal |
| Gene | Gla |
| Supplier Page | Shop |