MEF2BNB Antibody
| Name | MEF2BNB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47380 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MEF2BNB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MEF2BNB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-47380] - Staining of human cerebral cortex shows granular cytoplasmic positivity in glia cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4281_MEF2BNB%2520Antibody-Immunohistochemistry-Paraffin-NBP2-47380-img0002.jpg)
Immunohistochemistry-Paraffin: MEF2BNB Antibody [NBP2-47380] - Staining of human cerebral cortex shows granular cytoplasmic positivity in glia cells.