SYNPO2 Antibody
| Name | SYNPO2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48595 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGASETANIQRMVPMNRTAKPFPGSVNQPAT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYNPO2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYNPO2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/601_SYNPO2%2520Antibody-Immunohistochemistry-NBP2-48595-img0001.jpg)
Immunohistochemistry: SYNPO2 Antibody [NBP2-48595] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.