AP1S3 Antibody
| Name | AP1S3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49493 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AP1S3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AP1S3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: AP1S3 Antibody [NBP2-49493] - Staining of human cell line HaCaT shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10746_AP1S3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49493-img0002.jpg)
![Immunohistochemistry: AP1S3 Antibody [NBP2-49493] - Staining of human stomach shows moderate cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10747_AP1S3-Antibody-Immunohistochemistry-NBP2-49493-img0001.jpg)