TEKT1 Antibody

Name TEKT1 Antibody
Supplier Novus Biologicals
Catalog NBP2-49363
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
Purity/Format Immunogen affinity purified
Blocking Peptide TEKT1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TEKT1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.