ATP6V1D Antibody
| Name | ATP6V1D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49254 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:VNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATP6V1D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATP6V1D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ATP6V1D Antibody [NBP2-49254] - Analysis of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7791_ATP6V1D-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49254-img0001.jpg)
Immunocytochemistry/Immunofluorescence: ATP6V1D Antibody [NBP2-49254] - Analysis of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
![Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP2-49254] - Staining of human kidney shows strong luminal membranous positivity in proximal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7792_ATP6V1D-Antibody-Immunohistochemistry-Paraffin-NBP2-49254-img0002.jpg)
Immunohistochemistry-Paraffin: ATP6V1D Antibody [NBP2-49254] - Staining of human kidney shows strong luminal membranous positivity in proximal tubules.