APEH Antibody
| Name | APEH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85334 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | APEH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | APEH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: APEH Antibody [NBP1-85334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5688_APEH-Antibody-Western-Blot-NBP1-85334-img0004.jpg)
Western Blot: APEH Antibody [NBP1-85334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry: APEH Antibody [NBP1-85334] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5689_APEH-Antibody-Immunohistochemistry-NBP1-85334-img0003.jpg)
Immunohistochemistry: APEH Antibody [NBP1-85334] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
![Simple Western: APEH Antibody [NBP1-85334] - Simple Western lane view shows a specific band for APEH in 0.2 mg/ml of RT4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5690_APEH-Antibody-Simple-Western-NBP1-85334-img0005.jpg)
Simple Western: APEH Antibody [NBP1-85334] - Simple Western lane view shows a specific band for APEH in 0.2 mg/ml of RT4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: APEH Antibody [NBP1-85334] - Electropherogram image of the corresponding Simple Western lane view. APEH antibody was used at 1:25 dilution on RT4 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5691_APEH-Antibody-Simple-Western-NBP1-85334-img0006.jpg)
Simple Western: APEH Antibody [NBP1-85334] - Electropherogram image of the corresponding Simple Western lane view. APEH antibody was used at 1:25 dilution on RT4 lysate(s) respectively.