Trophinin / TRO antibody
| Name | Trophinin / TRO antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343304 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-TRO antibody is: synthetic peptide directed towards the C-terminal region of Human TRO. Synthetic peptide located within the following region: EAEARAEIYSPCLQIPLINCSSPSHGAKVHPWNLCPHSSQGSYGQSAEGV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TRO |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TRO; Sample Tissue: HT1080 Whole cell lysates; Antibody Dilution: 1.0 ug/ml