TBPL2 antibody
| Name | TBPL2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331442 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-TRF3 antibody: synthetic peptide directed towards the N terminal of mouse TRF3. Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR. |
| Description | Rabbit Polyclonal |
| Gene | Tbpl2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TRF3 Antibody Titration: 5.0ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate