SPPL2B antibody

Name SPPL2B antibody
Supplier Acris Antibodies
Catalog TA335377
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Human, Pig, Rat
Antigen The immunogen for Anti-SPPL2B Antibody is: synthetic peptide directed towards the N-terminal region of Human SPPL2B. Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SPPL2B
Supplier Page Shop

Product images