SLC37A3 / SPX3 antibody
| Name | SLC37A3 / SPX3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333311 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-SLC37A3 Antibody: synthetic peptide directed towards the middle region of human SLC37A3. Synthetic peptide located within the following region: FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC37A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC37A3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate