SLC25A41 antibody

Name SLC25A41 antibody
Supplier Acris Antibodies
Catalog TA334619
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rat
Antigen The immunogen for anti-Slc25a25 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Slc25a25. Synthetic peptide located within the following region: MSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SLC25A41
Supplier Page Shop

Product images