NT5M antibody

Name NT5M antibody
Supplier Acris Antibodies
Catalog TA344803
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-NT5M antibody: synthetic peptide directed towards the N terminal of human NT5M. Synthetic peptide located within the following region: ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene NT5M
Supplier Page Shop

Product images