HIATL1 antibody
| Name | HIATL1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342890 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-HIATL1 antibody: synthetic peptide directed towards the C terminal of human HIATL1. Synthetic peptide located within the following region: GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL. |
| Description | Rabbit Polyclonal |
| Gene | HIATL1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-HIATL1 Antibody; Titration: 1.0 ug/ml; Positive Control: U937 Whole Cell