FTHL17 antibody

Name FTHL17 antibody
Supplier Acris Antibodies
Catalog TA339588
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-FTHL17 antibody: synthetic peptide directed towards the N terminal of human FTHL17. Synthetic peptide located within the following region: MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene FTHL17
Supplier Page Shop

Product images