DDX26B antibody
| Name | DDX26B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341634 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-DDX26B antibody: synthetic peptide directed towards the N terminal of human DDX26B. Synthetic peptide located within the following region: ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ. |
| Description | Rabbit Polyclonal |
| Gene | DDX26B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-DDX26B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate