CXorf67 antibody

Name CXorf67 antibody
Supplier Acris Antibodies
Catalog TA333321
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-CXorf67 Antibody: synthetic peptide directed towards the middle region of human LOC340602. Synthetic peptide located within the following region: RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene CXorf67
Supplier Page Shop

Product images