Name | CIITA / C2TA antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA341750 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Human, Mouse, Rat |
Antigen | The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN. |
Description | Rabbit Polyclonal |
Gene | Ciita |
Supplier Page | Shop |